Protein Info for Dsui_3479 in Dechlorosoma suillum PS

Annotation: single stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00621: single-stranded DNA-binding protein" amino acids 2 to 164 (163 residues), 186.5 bits, see alignment E=2.3e-59 PF00436: SSB" amino acids 4 to 108 (105 residues), 141.2 bits, see alignment E=5.5e-46

Best Hits

Swiss-Prot: 59% identical to SSB_RALSO: Single-stranded DNA-binding protein (ssb) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 62% identity to bpm:BURPS1710b_0781)

MetaCyc: 56% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL94 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Dsui_3479 single stranded DNA-binding protein (Dechlorosoma suillum PS)
MAAVNKVILLGNLGADPETRYMPNGDAVATVRLATTETWKDRNSGEKREATEWHRVVFFR
KLAEIVGQYLKKGSSVYIEGRIRTRKWQDKDGQERYTTEIEATEMQMLGGRGGQGGQGGG
SGASYGGGDDFGGGDFSPRSSAPAASAPKKKAPSFDDMDDDIPF