Protein Info for Dsui_3472 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 93.6 bits, see alignment E=4.4e-31

Best Hits

Swiss-Prot: 36% identical to CHEY_RHIEC: Probable chemotaxis protein CheY (cheY) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 81% identity to slt:Slit_1590)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL87 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Dsui_3472 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MAKTILIVDDSASLRQVVSIALKGAGYETLEACDGQDGLNKLKGQKVHLIISDVNMPVMD
GITFVTELKKLPEHRFTPVIMLTTEAGDSMKQRGQAAGAKAWVVKPFQPAQMLTAVTKLV
MP