Protein Info for Dsui_3467 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00072: Response_reg" amino acids 9 to 116 (108 residues), 96.6 bits, see alignment E=3.6e-31 PF00158: Sigma54_activat" amino acids 146 to 311 (166 residues), 226.1 bits, see alignment E=7.8e-71 PF14532: Sigma54_activ_2" amino acids 147 to 316 (170 residues), 65.7 bits, see alignment E=2e-21 PF07728: AAA_5" amino acids 169 to 285 (117 residues), 25.7 bits, see alignment E=3.5e-09 PF25601: AAA_lid_14" amino acids 317 to 374 (58 residues), 59 bits, see alignment 1.2e-19 PF02954: HTH_8" amino acids 399 to 438 (40 residues), 34.5 bits, see alignment 4.8e-12

Best Hits

Swiss-Prot: 55% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 71% identity to dar:Daro_2148)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL82 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Dsui_3467 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MSEAAALPVFLVEDDPAVRMGSAQALTLAGLEVRSFADAEGALAALAAELPGAVVSDVRL
PGRDGIALLGELRQLDRELPVILVTGHGDVAMAVQAMRDGAHDFIEKPFTSEHLVRVTRQ
ALEKRALLLENRRLKEALPTQDGLPVIGQTPAMQEVRRLVAALAPTDVDILINGETGSGK
EVVARAIHSASGRRGPFVAINCAALPESVFESEMFGHEAGAFTGAGKRRIGKIEYAHGGT
LFLDEIESMPLNLQVKLLRALQERSIERLGGNAPVAVDCRVVAASKADLKALSEAGQFRA
DLYYRLNVVSIDLPPLRRRQEDIPLLMGHFLQQAAKRFGREVPAWGPAELARWQAQPWPG
NVRELKNAAERFCLGLDQPQAASPAGSAPGAELPLARRLELAEQGFIEAALAACHGNVAL
AAERLQLPKKTLYDKLARLQIAADTFRR