Protein Info for Dsui_3463 in Dechlorosoma suillum PS

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 80 to 102 (23 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 265 (172 residues), 86.5 bits, see alignment E=9.7e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 88% identity to dar:Daro_2152)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL78 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Dsui_3463 ABC-type nitrate/sulfonate/bicarbonate transport system, permease component (Dechlorosoma suillum PS)
MLKKLQAFAHGALVPVLVLILWEAGSRAGLFSEVLLPSPSAVAVKWWAYLLPTQDYVPGS
GSYFTWLISGELLHDAYSSLYRVIVGFIIGAGLALPLGLVMGANNRIYDLFNPLVQILRP
IPPIAYIPLAILWFGLGNPPSFFLIAIGAFFPVLMNTIAGVRHVDGIYLRAARNLGVNYW
TMFTRVILPASTPYILAGVRIGIGTAFIVVIVSEMIAVNDGLGFRILEAREFMWSDKIIA
GMITIGLLGLAIDTAVSRLNNHLLRWHRGLEH