Protein Info for Dsui_3453 in Dechlorosoma suillum PS

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 292 (271 residues), 266.3 bits, see alignment E=1.5e-83 PF01545: Cation_efflux" amino acids 24 to 214 (191 residues), 156.4 bits, see alignment E=4.1e-50

Best Hits

Swiss-Prot: 36% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 61% identity to tbd:Tbd_0726)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL68 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Dsui_3453 cation diffusion facilitator family transporter (Dechlorosoma suillum PS)
MAHAHHHDCGHGHAHSHHHGGKGLLLATLLTLGFAGVEAVAGAWSGSLALIGDAGHMVND
GVALALAAAAAWVARRPPSHRHTYGWGRAEVLAALLNGLAMLALVVAILVEAVQRFQDPA
PVAGPAVMAVAVVGLLMNTLVAWMLSRGESSLNTRAALLHVLGDMLGSVAAIASGAIVYF
TGWKQADPLLAAGIALLISVSSLRLLREALHALMEGTPPHISAAEVGAAMEQVDGVLGVY
DLHVWTVGDGEVMLSAHLQVADLAAWPQTLAGLRQVLQQRWHIRHVTLQPETDPIEPLHR
PA