Protein Info for Dsui_3449 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 PF00072: Response_reg" amino acids 31 to 140 (110 residues), 88.2 bits, see alignment E=1.5e-28 TIGR00229: PAS domain S-box protein" amino acids 150 to 274 (125 residues), 68.7 bits, see alignment E=5.2e-23 PF13188: PAS_8" amino acids 158 to 202 (45 residues), 31.7 bits, see alignment 3.6e-11 PF00989: PAS" amino acids 159 to 265 (107 residues), 50.1 bits, see alignment E=9.3e-17 PF08448: PAS_4" amino acids 160 to 270 (111 residues), 24.2 bits, see alignment E=1.1e-08 PF13426: PAS_9" amino acids 165 to 267 (103 residues), 55.5 bits, see alignment E=2.2e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 278 to 438 (161 residues), 154.6 bits, see alignment E=2e-49 PF00990: GGDEF" amino acids 279 to 436 (158 residues), 178.2 bits, see alignment E=3.8e-56 PF00563: EAL" amino acids 456 to 690 (235 residues), 237.4 bits, see alignment E=5.2e-74

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL64 at UniProt or InterPro

Protein Sequence (714 amino acids)

>Dsui_3449 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MAPPDAVMTPRMDNAARQDDPERELLRGLRVLLVEDDPVARCAAAGILSRHVGTLWEAAD
GDEGLQLFRRHQPDLVISDIVMPHRDGLSLAREIKAQSPATPIVIITSHSDSGALLDAIE
IGIDRYVLKPLKASALLEAMATCARAARLESEHRLATTVFHASSEAIMITDAENRIVDVN
PAFTRITGFSRGEVLGRNPRILQSGIQSEHFYREMWAAINQYGHWRGEIWNRRRNGELYP
EWLAVDRVLSPEGAVLNYVAMWSDISERKEAEARIHYLAHYDALTDLPNRVLFNDRFTQA
LIHARRYDQSVALMFVDLDRFKVVNDTLGHRVGDELLKQVAERLRRCVREEDTVSRQGGD
EFVVLLANLDMSADAAVVSDKILEALAEPMYFEGHELSVTCSIGIACYPSDGADPDTLMK
NADLAMYRAKSVGRNNYQFFSPELEQGALTRLTLENAMRRALDRDEFELHYLPQVDNPSG
RLLSLEALIRWQHPERGLLLPSQFIPLAEESGLVLPISLWVLRRVARQLADWRRQNLTLV
PVAINLCEAQLRQPDFAEALGRILSEEGVEGRWIELEFTEGALMHDTERNLRVLSALKRL
GVGITLDDFGVGYSNLNVLRRLPVDTLKIDRSLVTDVTRNEDDAVIVDAIISMAQSMNLK
VVAEGVETADQAGFFKARACAEIQGHFFSKAIGAVEVAAMLGHAPAAASTSSPA