Protein Info for Dsui_3416 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00392: GntR" amino acids 28 to 90 (63 residues), 79 bits, see alignment E=1.7e-26 PF07729: FCD" amino acids 114 to 237 (124 residues), 91.2 bits, see alignment E=7.1e-30

Best Hits

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 58% identity to azo:azo0997)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKK7 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Dsui_3416 transcriptional regulator (Dechlorosoma suillum PS)
MAASPSLAIPAAPGSARGRGVGPSAGLSADIGAALEQRIRSGAYAPGARLPTEMALAAEF
GVSRAVVREAVARLKADGLVASRQGSGMSVAARPDSGSFKLAPGTPAGEALSHIFELRAL
VETGAAELAARRRTPADLAAMYAALQAMGEAVRQGDDGAEDDDVFHQAIAAATHNPEIRR
FVSFLSAQFSESRRPTWDAAGHVTGRAAAAQAEHERLYAAIAAGDAVAARQAAAGHLYQA
AARVGAAPQATCLEAKLAVGPAHEENDHG