Protein Info for Dsui_3401 in Dechlorosoma suillum PS

Annotation: putative Zn-dependent protease-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF01523: PmbA_TldD_1st" amino acids 38 to 100 (63 residues), 51.8 bits, see alignment E=1.1e-17 PF19290: PmbA_TldD_2nd" amino acids 127 to 236 (110 residues), 75.4 bits, see alignment E=6.8e-25 PF19289: PmbA_TldD_3rd" amino acids 244 to 477 (234 residues), 237.3 bits, see alignment E=1.8e-74

Best Hits

KEGG orthology group: K03568, TldD protein (inferred from 80% identity to dar:Daro_3328)

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKJ2 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Dsui_3401 putative Zn-dependent protease-like protein (Dechlorosoma suillum PS)
MSKIIKQAESLLLTPYGLDDKRLSEVFGQIMKNDVDYADLYFQYSRAEAWSLEEGIVKSG
SFNIDQGVGVRAISGEKTAFAYSDDISRNALGDAAAAVRAIGAAGQSGTAPKLKGRKGHG
LYPAQDPIPSLQAADKVKLLERLEGYARAIDSRVTQVMASLASEYDVVLVAGSDGRLAAD
VRPLVRVSVTVIVDGGKGKREQGSAGGGGRYDYGYFSEEVLKRYAAEAVHQAVTNLDARP
APAGTMTVVLGPGWPGILLHEAIGHGLEGDFNRKGSSAFSGRIGERVAAKGVTVVDDGTL
PDRRGSLNIDDEGNPTRRTVLIEDGILKGYMQDSLNARLMGVEPTGNGRRESFAHLPLPR
MTNTIMLAGDKSPEEILKSVKKGIYAVNFGGGQVDITSGKFVFSMSEAYMVENGKVLYPV
KGATLIGNGPDALTRVKMIGNDLGLDPGVGTCGKDGQSVPVGVGQPTLRIDGLTVGGTA