Protein Info for Dsui_3394 in Dechlorosoma suillum PS

Annotation: P-type ATPase, translocating

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 915 transmembrane" amino acids 58 to 82 (25 residues), see Phobius details amino acids 88 to 104 (17 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 278 to 305 (28 residues), see Phobius details amino acids 708 to 727 (20 residues), see Phobius details amino acids 733 to 752 (20 residues), see Phobius details amino acids 773 to 793 (21 residues), see Phobius details amino acids 805 to 822 (18 residues), see Phobius details amino acids 841 to 861 (21 residues), see Phobius details amino acids 873 to 892 (20 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 11 to 78 (68 residues), 59.2 bits, see alignment 7.3e-20 TIGR01494: HAD ATPase, P-type, family IC" amino acids 90 to 352 (263 residues), 147.4 bits, see alignment E=2.3e-47 amino acids 608 to 729 (122 residues), 115.6 bits, see alignment E=1e-37 PF00122: E1-E2_ATPase" amino acids 121 to 231 (111 residues), 86.7 bits, see alignment E=2.5e-28 PF00702: Hydrolase" amino acids 329 to 654 (326 residues), 59.2 bits, see alignment E=2.2e-19 PF13246: Cation_ATPase" amino acids 383 to 548 (166 residues), 116.9 bits, see alignment E=2.8e-37 PF08282: Hydrolase_3" amino acids 626 to 683 (58 residues), 21.2 bits, see alignment 6.3e-08 PF00689: Cation_ATPase_C" amino acids 725 to 895 (171 residues), 151.4 bits, see alignment E=6.9e-48

Best Hits

Predicted SEED Role

"Cation-transporting ATPase, E1-E2 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKI5 at UniProt or InterPro

Protein Sequence (915 amino acids)

>Dsui_3394 P-type ATPase, translocating (Dechlorosoma suillum PS)
MPRPAASSPVWHHLSGDAVAEHWQTSCAEGLSEAEVECRRQTHGENRLTPKPGKGPLLRF
ALQFAQPLVLVLLLAGAVTAFLGEWVDSGVIFGVTLINAIIGFIQEGKAESALAALARSV
ASEVTVLREGEKKRLPSRALVPGDVVLLAAGDKVPADLRLFRAKEMKAMEAALTGESTAS
DKHAETLPPETLLADRGNMAYAGTMVVSGQGAGITIATGDATETGRISKLMGETPDLMTP
LTRKMAAFSNWLLMAIGALALFTFAVGLWRGESPFEMFMAAVALAVGAIPEGLPAAMTIT
LAIGVSRMAKRRAIIRKLPAVETLGSTTVICSDKTGTLTENQMTVREVVAGGIAYPVSGN
GYAPEGEIGGRRLGNEAPPEPALRETLLAAALCNDAGLFKEGRHWQISGDPTEAALLVAA
RKAGLDEHTLLSLYPRQDELPFDSARQYMATLHRGDGGLVVYAKGALEKLLPHCRRRCNA
EGLPVPLTAADAAAIERQAREMAARGLRVLAVARRGWAAGAVLEADSLIAGEGLDYLGLI
GMMDPPRAQAVAAVKACRNAGIRVKMITGDHAVTALAIARQIGIAAEGEQALSGGELAAL
DDAGLQAAVQQINVFARVEPEQKLRLVRALQAQGQVVAMTGDGVNDAPALKQANIGIAMG
ITGTEVAKEAAAMVLTDDNFAAIEAAVEEGRGVFDNLVKFITWTLPTNFGEGLVIVAAIV
AGATLPITPLQILWINMTTAVFLGLMLAFEPIEKGVMARPPRAPQTPVQDAPLVGRILLV
SLLLLLGAFGLFLRELDQGHTLAEARTVAVNVFVLVETVYLFNCRSLTHSFWSIGLFTNR
WFWGGIGTMVALQLLFTYAPIMNRLFATAPIGLTEWLEIGAFALFCGLVIGTEKRLRLGF
ARRQAVRNLPGSGRL