Protein Info for Dsui_3384 in Dechlorosoma suillum PS

Annotation: transporter, monovalent cation:proton antiporter-2 (CPA2) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 217 to 250 (34 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 9 to 374 (366 residues), 211.4 bits, see alignment E=2.9e-66 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 284 (271 residues), 240.5 bits, see alignment E=1.2e-75 PF02254: TrkA_N" amino acids 410 to 523 (114 residues), 89.8 bits, see alignment E=2.5e-29 PF02080: TrkA_C" amino acids 591 to 649 (59 residues), 35.7 bits, see alignment 9.5e-13

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 47% identity to lhk:LHK_02018)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKH5 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Dsui_3384 transporter, monovalent cation:proton antiporter-2 (CPA2) family (Dechlorosoma suillum PS)
MTDSLFSVVLLLSLAVLFVVVAKQLRLPSLLAYLAIGLIVGPYGFGLLAESEEASHFAEF
GVVFLMFSIGLEFSLARLKAMHRLVFGLGGAQVGVTLVGTTLVTILYYGQDWRIGLAVGA
ACAMSSTAIVSKLLSERLELHSQPGRQTMAVLLFQDLAVVPLLIIIPALAADAKGMAGAI
SMALGQAALALVAMILVGQRLMRRWFDAVARQKSPELFMLSVLWIVIGLSALTAWAGLSL
ALGAFIGGMLISETLYRHQVEADIRPFRDVLLGLFFVTIGMLLDLQFVLQNLPAVLLALA
LLVLAKGGIVFLITLLMRNSPEVGARTAIQLAQAGEFGFVLLELARDNKLLPTDVFQVTM
AAMLLSMFIAPLLIGQAGRWSKHLSRQEWSDRTRMIHEVAVHAMGIEQHVILCGFGRTGQ
SVARFLDLESIPFIALDVDEARIRQAVEAGENVVYGNADRREILKAAGLDRARALVVTYA
DLPATEKVLHLVRELRPDMPIIVRAQDDLHLEHLKSLGATEVIPEVLEGSLMLAAQTLTQ
LGVPVERALEQVREVRAHRYTALRAFYRGESDRLQRISQEKLACVIEQQAYAVGRSLAEL
DLGRFGVELEALRRHRVRDEAPLPETVVQPEDVLILVGTSEALSAAMHFILDGK