Protein Info for Dsui_3373 in Dechlorosoma suillum PS

Annotation: Na+/phosphate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 180 to 206 (27 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 20 to 160 (141 residues), 138.8 bits, see alignment E=6.4e-45 amino acids 183 to 258 (76 residues), 34.6 bits, see alignment E=9.2e-13

Best Hits

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK24 at UniProt or InterPro

Protein Sequence (563 amino acids)

>Dsui_3373 Na+/phosphate symporter (Dechlorosoma suillum PS)
MTAGTSLLGLLTALLGGIGLFLLGMTMLTDGLKLAAGRALERILAAWTRTRLHGLITGIC
VTALVQSSTAMTVAAIGFVNAGLLSFAAALWVVFGSNLGSSVTGWLVAWIGFKISIDAFA
LPFIGIGMALKLTGEGTRRSGLGMSLAGFGLLFLGIELLKDGFAGLGPDALPRLGSDPGA
LALAILIGIALTVILQASAATLTLALTAVAGGMLPLTAAAALVIGANVGTTLTGIVAAIG
ATANAKRLAAAHVFFNVATAVVAAALLVPLLWLSKAIDLGLGDGDDPVTQLVIFHTLFNA
LGVVLMGLLSRWLVPFLLSRFASTEDNAAHPRYLDRNVATVPQLALQALRRELARVAHLA
LELGDLACRHLQQQAPADAVQFTRRLEVIEKLQAEIGRFVGEVSRRQVHRDQAEQLPELL
RIANYYDTLARVMYHVALSGQAGPRVLTSPNRDEQTDLLAAVAPVLVSAQAFFGAADPDC
GEAPENIALRAEEARDSFEDTYQRSKAALLQAGAGGTDVNAMYDWLACLSDLRRAVAQGF
KASQRFASLPELKEPALDSESED