Protein Info for Dsui_3347 in Dechlorosoma suillum PS

Annotation: acetyltransferase, N-acetylglutamate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00583: Acetyltransf_1" amino acids 32 to 111 (80 residues), 39.6 bits, see alignment E=1.1e-13 PF13673: Acetyltransf_10" amino acids 36 to 115 (80 residues), 26.7 bits, see alignment E=9.8e-10 PF13508: Acetyltransf_7" amino acids 36 to 112 (77 residues), 38.8 bits, see alignment E=2e-13 PF09719: C_GCAxxG_C_C" amino acids 174 to 299 (126 residues), 81.8 bits, see alignment E=8.5e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJZ8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Dsui_3347 acetyltransferase, N-acetylglutamate synthase (Dechlorosoma suillum PS)
MFQIRQAAGADHDAIHALLSLAHPDEPSHCRQVEDVVYVADSDVGLVGAGGLAPCGDVAL
LHSLIVRPGFRKQRIARQLYQHVLDHAYGMGIRELYTLTASSRTYFETLGFTPAHRDTAP
ESLRQALLRDDPDPDQTALMRRSLAHARSVPSTPHSYHGVDPTSQAGDFFDSGFYCAESV
LLALARHMGLDSPLIPGIATGFCSGLSRTWGTCGAYSGGVLALNLALGRSDPREPVTANY
DAIQRFTDEFRATCGGGHCSELLGCDLQTQEGRQVYRENHLHAQCREYVVIATRLAREIL
DQQNGDERLPNL