Protein Info for Dsui_3344 in Dechlorosoma suillum PS

Annotation: phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 13 to 144 (132 residues), 129.2 bits, E=1.8e-41
• PF02879: PGM_PMM_II
  • amino acids 159 to 256 (98 residues), 106.3 bits, E=2.3e-34
• PF02880: PGM_PMM_III
  • amino acids 261 to 357 (97 residues), 72.5 bits, E=6.6e-24
• PF00408: PGM_PMM_IV
  • amino acids 375 to 453 (79 residues), 52.7 bits, E=7.1e-18

Best Hits

Swiss-Prot: 59% identical to PGM_NEIMB: Phosphoglucomutase (pgm) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 82% identity to dar:Daro_3299)

MetaCyc: 57% identical to phosphomannomutase (Pseudomonas aeruginosa)
Phosphomannomutase. [EC: 5.4.2.8]; Phosphoglucomutase. [EC: 5.4.2.8, 5.4.2.2]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
• GDP-α-D-glucose biosynthesis (1/3 steps found)
• trehalose degradation V (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucose and glucose-1-phosphate degradation (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• peptidoglycan recycling I (8/14 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• chitin biosynthesis (4/9 steps found)
• sucrose biosynthesis II (3/8 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• glycogen degradation II (1/6 steps found)
• starch biosynthesis (3/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• glycogen degradation I (1/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See G8QJZ5 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Dsui_3344 phosphomannomutase (Dechlorosoma suillum PS)
MNASVQIPALPPEIFKAYDIRGIVGKSLTADVVRAIGHGLGSLARERQQTAIAIGRDGRL
SGPELAGALADGIRAAGVDVIDIGCVPTPVTYFAAHHLGCHSCVSVTGSHNPPDYNGLKM
VIGGETLAGEAIQALKRRIEAGDLARGEGKLTQADVKAAYVERILADVKLARPMKIVMDC
GNGVAGAVAPELFKKLGCDIVPLFCEVDGTFPNHHPDPSKPENLADVIRALKETDAEIGI
AFDGDGDRLGVVTKDGEVIFPDRQLMLFAADVLSRVPGGEIVYDVKCTRLLAPWIREHGG
KPVMWQTGHALIKKKLKESGAPLAGEMSGHVFFKERWFGFDDGLYTGARLLEILARAADA
NPVLKGLPNATSTPELNIKMAEGEPFALLDKLKAGAKFEAAREIITIDGLRVEYADGFGL
ARPSNTTPVVVLRFEADNAEALARIQADFRRELAAAWPGLTLPF