Protein Info for Dsui_3327 in Dechlorosoma suillum PS

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 32 to 32 (1 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 8 to 178 (171 residues), 75.8 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: None (inferred from 61% identity to app:CAP2UW1_2519)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJX8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Dsui_3327 cytochrome b (Dechlorosoma suillum PS)
MSTQKIKVWDLPTRLFHWLLAALVLGAVVTGQVGGNAIFVHGKLGLAIVGLLVFRLVWGV
AGSTYARFSQFVPGPGAIKAYLQGRWQGLGHNPLGALSVLALLALLLFQVVSGLFANDDI
AFRGPLMDLVGKDLSDTLSGLHKGAFPLILALVLVHVGAIVFYARVKKDNLVKPMLTGWK
ELPAAQPAVPATAHAQGGGLVAFIVALALAALAVWGASGVWIAPPPPPPASAPATPSW