Protein Info for Dsui_3316 in Dechlorosoma suillum PS

Annotation: Gram-negative bacterial tonB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 50 to 74 (25 residues), see Phobius details PF03544: TonB_C" amino acids 177 to 255 (79 residues), 77.4 bits, see alignment E=4.7e-26 TIGR01352: TonB family C-terminal domain" amino acids 179 to 255 (77 residues), 66.8 bits, see alignment E=8.5e-23

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 38% identity to pna:Pnap_2568)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJW8 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_3316 Gram-negative bacterial tonB protein (Dechlorosoma suillum PS)
MAALATAFPAVPRALVGMPLRGPSRPEKDRFLSASLPSPWPSLSRGRRGSIFLLVLALHG
GGLAYALHSGSAVVSAMVPQPMSVRLIDAAPAARPQPEVAPPQPMPPKVERPRQPKAPAP
VPLAKTPAPILAATPAAAVSSDFVAPEAPPSRPASSTIAAAPALVPARFDADYLHNPKPV
YPPMSRRFGEEGKVLLKVRVTPQGTAEQVDIQTGSGYSRLDSAAREAVQRWRFVPARRGD
EAVAASVIVPITFALDS