Protein Info for Dsui_3304 in Dechlorosoma suillum PS

Annotation: NADH:ubiquinone oxidoreductase chain I-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details PF00037: Fer4" amino acids 74 to 91 (18 residues), 28.5 bits, see alignment (E = 6.3e-10) amino acids 258 to 274 (17 residues), 22.1 bits, see alignment (E = 6.8e-08) PF12800: Fer4_4" amino acids 74 to 87 (14 residues), 17.7 bits, see alignment (E = 2.3e-06) amino acids 258 to 272 (15 residues), 15.6 bits, see alignment (E = 1.1e-05) PF12838: Fer4_7" amino acids 74 to 130 (57 residues), 37.6 bits, see alignment E=1.6e-12 amino acids 225 to 274 (50 residues), 30.5 bits, see alignment 2.7e-10 PF12798: Fer4_3" amino acids 75 to 89 (15 residues), 18.8 bits, see alignment (E = 1.5e-06) amino acids 260 to 274 (15 residues), 12.7 bits, see alignment (E = 0.00013)

Best Hits

KEGG orthology group: None (inferred from 63% identity to dar:Daro_1566)

Predicted SEED Role

"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJV6 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Dsui_3304 NADH:ubiquinone oxidoreductase chain I-like protein (Dechlorosoma suillum PS)
MSDNNPESDTPAGNAAKPAGSAKQRTARRRFIRSSLLTGGIVGLALLGYLPVARASRTRL
RPPGALDEKDFLASCIKCGQCVQVCPVQAIKLGDLTDGYGIGVPHIDAREQACDFSCDAG
QCILACPTGALTYDKPGFLAVRPGAHLARLPILKAKEKDPEPTLNLKERMGLARLAQPQI
CLAAQGKGFKGQARGAGFKGTMRYMDVDRWKPIPVADHPYERELCDLCVTECPIKDAIRL
KFVDNGDGVKRAVPEVLEQCVGCGVCEMICPVEAGGMAAIVVDERKTWEA