Protein Info for Dsui_3299 in Dechlorosoma suillum PS

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00578: AhpC-TSA" amino acids 33 to 153 (121 residues), 82.6 bits, see alignment E=7e-27 PF08534: Redoxin" amino acids 33 to 168 (136 residues), 90.6 bits, see alignment E=2.6e-29 PF00255: GSHPx" amino acids 39 to 98 (60 residues), 29.2 bits, see alignment E=1.8e-10 PF13098: Thioredoxin_2" amino acids 55 to 169 (115 residues), 28.1 bits, see alignment E=6.4e-10 PF13905: Thioredoxin_8" amino acids 56 to 151 (96 residues), 38.6 bits, see alignment E=3.5e-13 PF00085: Thioredoxin" amino acids 57 to 107 (51 residues), 36.1 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: None (inferred from 51% identity to dar:Daro_1561)

Predicted SEED Role

"Cytochrome c-type biogenesis protein ResA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJG1 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Dsui_3299 Peroxiredoxin (Dechlorosoma suillum PS)
MPMLPLRSSLAALASALLFAAPLAAVAEEQASAAPLFAASFPDTAGEKVNLERYRGKPLV
VNFWARWCGPCRKEIPDLVSIQNKYKAKGLTIVGVAVEEGKEAVKEFASAYEVNYPVLVS
GLQPGLDLMRQLGNEKAGLPYTVILDRQGHIVARKLGGMKLEDLDKALAPLF