Protein Info for Dsui_3285 in Dechlorosoma suillum PS

Annotation: histidine kinase,HAMP domain-containing protein,histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details PF14827: dCache_3" amino acids 78 to 327 (250 residues), 35.6 bits, see alignment E=2.6e-12 PF17201: Cache_3-Cache_2" amino acids 207 to 343 (137 residues), 56.6 bits, see alignment E=9.5e-19 PF17202: sCache_3_3" amino acids 228 to 338 (111 residues), 99.1 bits, see alignment E=6.3e-32 PF00672: HAMP" amino acids 366 to 415 (50 residues), 42.6 bits, see alignment 2.2e-14 PF00512: HisKA" amino acids 463 to 525 (63 residues), 52.2 bits, see alignment E=1.9e-17 PF02518: HATPase_c" amino acids 575 to 687 (113 residues), 84.7 bits, see alignment E=2.3e-27

Best Hits

KEGG orthology group: None (inferred from 50% identity to mms:mma_3674)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJE7 at UniProt or InterPro

Protein Sequence (709 amino acids)

>Dsui_3285 histidine kinase,HAMP domain-containing protein,histidine kinase (Dechlorosoma suillum PS)
MSGRLGAWLRHPGRRLEELQASFAGSVRLKLLALVLAPLLLGVPVLLLIVWIWGTQGYNQ
LLVNKVSSDLVTARQFFDRVQSGVSLNLEGFSSSHRLLQALQRGAPDDMDLLLQEAALAQ
GLDYLVLLDSHGRVRAGGRGPVDRSAWDVVQSALQGRGQHGLEVFAPEQLDELAPALRQR
AHLDLLPTRNASPDPRRAEDRGLVIQAAVPVLGSEGQMLGVLEGGVLLNGNLGIVDRINT
IVYQQASLPLGSQGTATLFLGDTRIATNVRLFEGRRALGTRVSQAVRDKVLGRGEVWLGS
AFVVDDTYVSGYEPLLNLRGERVGMLYVGFLEAPLQTALHGALAGLFLLFLLVSGLGTLA
ALRWAQTIFRPIERMNRVMARIEAGEETARVGPSASKDELGRLSRAFDHLLDSLSARRLE
LQRSADELDRKVAERTAALEEANATLRRAQQQLVMNEKLTAIGELTAGVAHEINNPVAVI
QGNLELLRDVLGEQAEPVRGEIRLIDEQTQRIRAIVTRLLQFARPGDFAGYAEATDVNGV
VADCLVLTRHNLNKAGVKVETRLEACCNVEMNRGELQQVLINLMMNAMQAMPQGGTLSME
SRDIGPGDAIPGEASFPGALLRVRDTGHGIAPADLDRIFDPFFTTKKQEGTGLGLSISYA
IIQRYGGRISVESAPGEHTTFTLWLRREAQYTEQPSAPVFAARFMKAGE