Protein Info for Dsui_3283 in Dechlorosoma suillum PS

Annotation: formate dehydrogenase accessory protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF04216: FdhE_N" amino acids 25 to 77 (53 residues), 60.9 bits, see alignment 2.9e-20 amino acids 83 to 164 (82 residues), 71.4 bits, see alignment E=1.8e-23 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 83 to 287 (205 residues), 204.3 bits, see alignment E=1.6e-64 PF24859: FdhE_central" amino acids 172 to 209 (38 residues), 67.8 bits, see alignment 1e-22 PF24860: FdhE_C" amino acids 212 to 286 (75 residues), 87.3 bits, see alignment E=9.7e-29

Best Hits

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJE5 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Dsui_3283 formate dehydrogenase accessory protein FdhE (Dechlorosoma suillum PS)
MTLSAHDDTAAAMAAAGLVPGQSPSPVRLPAAASVFKTRAARLRQLAEGHSLGDWLGFVA
TLSDAQQQRIDAAPGLTPGASPEQQWQSDLQALLALLQDQVPEPARPTLAALQQADAASL
SALAERIVGGTMEADDMILAPFVMAALQVAWTRHAAGLDAASVAAPATAHSCPVCGSAPV
AGVIHVGNESGGLRYLHCGLCHTAWHHVRATCVACGEGKEVSYRALDEREDGARAEACDT
CHNYLKLLLAEKAPGLDPIADDMATLALDILVSEEGYQRIGINPFLLLGE