Protein Info for Dsui_3281 in Dechlorosoma suillum PS

Annotation: formate dehydrogenase, beta subunit, Fe-S containing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 7 to 290 (284 residues), 470.4 bits, E=8.4e-146
• PF12800: Fer4_4
  • amino acids 35 to 48 (14 residues), 15 bits, see alignment (E = 1.4e-05)
  • amino acids 132 to 146 (15 residues), 16.9 bits, see alignment (E = 3.4e-06)
• PF12838: Fer4_7
  • amino acids 36 to 115 (80 residues), 27.8 bits, E=1.4e-09
• PF13247: Fer4_11
  • amino acids 93 to 189 (97 residues), 88.8 bits, E=1.2e-28
• PF13237: Fer4_10
  • amino acids 95 to 145 (51 residues), 33 bits, 2.3e-11
• PF12797: Fer4_2
  • amino acids 127 to 146 (20 residues), 25.5 bits, see alignment (E = 4.5e-09)
• PF12837: Fer4_6
  • amino acids 128 to 149 (22 residues), 24.2 bits, see alignment (E = 1.2e-08)
• PF00037: Fer4
  • amino acids 129 to 148 (20 residues), 27 bits, see alignment (E = 1.4e-09)
• PF09163: Form-deh_trans
  • amino acids 247 to 290 (44 residues), 74.2 bits, 2.8e-24

Best Hits

Swiss-Prot: 71% identical to FDOH_ECOL6: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 82% identity to lhk:LHK_00802)

MetaCyc: 71% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• superpathway of C1 compounds oxidation to CO₂ (2/12 steps found)
• purine nucleobases degradation II (anaerobic) (10/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See G8QJE3 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Dsui_3281 formate dehydrogenase, beta subunit, Fe-S containing (Dechlorosoma suillum PS)
MALQSLDILRRSASPTAAPQARNPLEVAKLIDVSVCIGCKACQVACSEWNELRDDVGSCV
GVYDNPTDLSAQAWTVMRFNEVEQPDVSGGKLEWLIRKDGCMHCADPGCLKACPSPGAII
QYKNGIVDFHQENCIGCGYCVSGCPFNVPRINPKDNKAYKCNLCSDRVAVGQEPACVKTC
PTGAIQFGSKEDMQEVAAKRVTDLKSRGYDNAGLYDPQGVGGTHVMYVLHHADKPELYNN
LPKDPAISTTVSLWKGLLKPVATLGIAAAGLFGFFHYITVGPNRAEDEHEAEEVTK