Protein Info for Dsui_3267 in Dechlorosoma suillum PS

Annotation: biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 68 to 186 (119 residues), 102.5 bits, see alignment E=7.2e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 79% identity to app:CAP2UW1_0390)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJD0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Dsui_3267 biopolymer transport protein (Dechlorosoma suillum PS)
MFAIIQAAGWPIWPLLFASIIALALIIERLVALRRSKVAPEGLLARVVGEVRQGTVNEAA
INALEQGSPLGRVLAAGLRNVKSSREVMKESIEEAGRGVTHELERYLTTLGTIASISPLM
GLFGTVVGMIEIFGSQAPTGANPMQLAHGISIALYNTGFGLVIAIPAMIFWRHFRALVDS
FVIEMEQQAVKLVEVVHGERN