Protein Info for Dsui_3265 in Dechlorosoma suillum PS

Annotation: tetraacyldisaccharide 4''-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details PF02606: LpxK" amino acids 33 to 347 (315 residues), 367.1 bits, see alignment E=4e-114 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 38 to 340 (303 residues), 246.4 bits, see alignment E=2e-77

Best Hits

Swiss-Prot: 63% identical to LPXK_DECAR: Tetraacyldisaccharide 4'-kinase (lpxK) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 63% identity to dar:Daro_3208)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJC8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Dsui_3265 tetraacyldisaccharide 4''-kinase (Dechlorosoma suillum PS)
MALGPRLQKFWFRGALPRRGDGAPAWFDTLLFNLLTPISWLFRGLTALRRLAFRHGWLGS
ARLPVPVVVVGNIIVGGAGKTPLTLYLARQLRAAGLRPGIVSRGYGSAQEGVAAVSPEAT
PAQVGDEPLLLARESGCPVWIGRDRAAAARALLAASPDCNLILCDDGLQHYRLARDVEIA
VCDVRGLGNGRLLPVGPLREPRQRLAQVDAVVGNGMAAELLFSAKAATPPLFRMDLRPAS
FYGLQDPSRQCSAADLAGKRLYAVAGIGHPQRFFRTLAELGLTVEARAFPDHHAYTAADL
AFARDGVLLTTAKDGVKCAAIYGGEAWVLPVDAQLTPDLSAFVLEKINGRTVAGHPGLPG
VQE