Protein Info for Dsui_3258 in Dechlorosoma suillum PS

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF01050: MannoseP_isomer" amino acids 34 to 118 (85 residues), 32.2 bits, see alignment E=1.7e-11 PF07883: Cupin_2" amino acids 42 to 109 (68 residues), 57.3 bits, see alignment E=1.6e-19 PF02311: AraC_binding" amino acids 50 to 105 (56 residues), 24.6 bits, see alignment E=2.8e-09

Best Hits

Swiss-Prot: 50% identical to Y1618_METJA: Uncharacterized protein MJ1618 (MJ1618) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 69% identity to dvm:DvMF_2629)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJC1 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Dsui_3258 mannose-6-phosphate isomerase (Dechlorosoma suillum PS)
MSPVFHTARADIPAYRTKDGSEIRELMHPDVHGNRQQSLAEATVPPGTRTLLHRHRLSEE
LYHVTAGHGVMTLGERRFLIAVGDTVHIAPGTAHALENSGDQPLVVLCACSPAYRHDDTE
LLEAEAGSGV