Protein Info for Dsui_3258 in Dechlorosoma suillum PS
Annotation: mannose-6-phosphate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to Y1618_METJA: Uncharacterized protein MJ1618 (MJ1618) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: None (inferred from 69% identity to dvm:DvMF_2629)Predicted SEED Role
"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)
MetaCyc Pathways
- colanic acid building blocks biosynthesis (10/11 steps found)
- D-mannose degradation II (2/2 steps found)
- GDP-mannose biosynthesis (3/4 steps found)
- mannitol degradation II (3/4 steps found)
- β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
- D-mannose degradation I (1/2 steps found)
- 1,5-anhydrofructose degradation (3/5 steps found)
- mannitol biosynthesis (1/3 steps found)
- superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
- β-(1,4)-mannan degradation (2/7 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.3.1.8
Use Curated BLAST to search for 5.3.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QJC1 at UniProt or InterPro
Protein Sequence (130 amino acids)
>Dsui_3258 mannose-6-phosphate isomerase (Dechlorosoma suillum PS) MSPVFHTARADIPAYRTKDGSEIRELMHPDVHGNRQQSLAEATVPPGTRTLLHRHRLSEE LYHVTAGHGVMTLGERRFLIAVGDTVHIAPGTAHALENSGDQPLVVLCACSPAYRHDDTE LLEAEAGSGV