Protein Info for Dsui_3254 in Dechlorosoma suillum PS

Annotation: ribosomal protein S20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 TIGR00029: ribosomal protein bS20" amino acids 1 to 86 (86 residues), 90.3 bits, see alignment E=4.7e-30 PF01649: Ribosomal_S20p" amino acids 2 to 84 (83 residues), 96.6 bits, see alignment E=5.8e-32

Best Hits

Swiss-Prot: 86% identical to RS20_DECAR: 30S ribosomal protein S20 (rpsT) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02968, small subunit ribosomal protein S20 (inferred from 83% identity to app:CAP2UW1_1150)

MetaCyc: 59% identical to 30S ribosomal subunit protein S20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S20p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJB7 at UniProt or InterPro

Protein Sequence (88 amino acids)

>Dsui_3254 ribosomal protein S20 (Dechlorosoma suillum PS)
MANSAQARKRARQSEKQRAHNASLRSTLRTAIKRVQKAVLAGDKAAAQTVFQQSVAVLDR
IADKKIIHKNKASRHKSRLSAAIKALAA