Protein Info for Dsui_3249 in Dechlorosoma suillum PS

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF02729: OTCace_N" amino acids 5 to 144 (140 residues), 163.8 bits, see alignment E=3e-52 TIGR00658: ornithine carbamoyltransferase" amino acids 5 to 301 (297 residues), 366.7 bits, see alignment E=4.3e-114 PF00185: OTCace" amino acids 151 to 299 (149 residues), 186.4 bits, see alignment E=3.8e-59

Best Hits

Swiss-Prot: 86% identical to OTC_METFK: Ornithine carbamoyltransferase (argF) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: None (inferred from 89% identity to mei:Msip34_1560)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJB2 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Dsui_3249 ornithine carbamoyltransferase (Dechlorosoma suillum PS)
MSSIKHFLQFKDFTREEFDYLFARTRWIKDQFKNYKQYWPLTDRTLVMIFEKASTRTRLS
FEAGMQQLGGSAIYLNTRDSQLGRGEPVEDAAQVISRMSDIVMIRTFEQEIIERFAANSR
VPVINGLTNEYHPCQIMADIFTYIEHRGPIQGKTVAWIGDSNNVCNTWLQAAEVLDFNVH
VSTPPGYEVEAERAGLYGTANFEQFSDPMEAAKGADIVTTDVWTSMGFEAENEERLKDFA
DWQVDGDMMRIAKSDAIFLHCLPAHRGEEVTAEVIDGPQSAVWDEAENRLHTQKALMEYL
LLGRVNS