Protein Info for Dsui_3248 in Dechlorosoma suillum PS

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF00764: Arginosuc_synth" amino acids 6 to 169 (164 residues), 212.3 bits, see alignment E=4.2e-67 TIGR00032: argininosuccinate synthase" amino acids 6 to 402 (397 residues), 468.7 bits, see alignment E=9.4e-145 PF20979: Arginosuc_syn_C" amino acids 181 to 400 (220 residues), 267.4 bits, see alignment E=9.6e-84

Best Hits

Swiss-Prot: 91% identical to ASSY_AZOSB: Argininosuccinate synthase (argG) from Azoarcus sp. (strain BH72)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 91% identity to tmz:Tmz1t_2674)

MetaCyc: 49% identical to Argininosuccinate synthase (Homo sapiens)
Argininosuccinate synthase. [EC: 6.3.4.5]

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJB1 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Dsui_3248 argininosuccinate synthase (Dechlorosoma suillum PS)
MSDIKKVVLAYSGGLDTSVILKWLQDTYQCEVVTFTADLGQGEELEPARTKALKFGIKPE
NIFIDDLREEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEITNLTGADAISHG
ATGKGNDQVRFELGAYALKPGVKVIAPWREWDLLSREKLLAYAEQHGIPVEMKHKQGGSP
YSMDANLLHISYEGRHLENPAAEAEEDMWRWTVSPENAPDAAEYLDLEFVQGDLVAINGQ
NMKAHELLAKLNELGGKHGIGRLDLVENRYVGMKSRGCYETPGGTILLRAHRAIESITLD
REVAHLKDDLMPRYASLVYNGYWWAPERKALQTLIDHTQQTVNGTVRLKLYKGNVIVVGR
DSKTDSLFDPTIATFEDDAGAYDQKDAGGFIKLNALRMRIAANLKARKG