Protein Info for Dsui_3244 in Dechlorosoma suillum PS

Annotation: GMP synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00117: GATase" amino acids 30 to 179 (150 residues), 57.7 bits, see alignment E=1.3e-19 PF07722: Peptidase_C26" amino acids 69 to 102 (34 residues), 24.8 bits, see alignment 1.7e-09

Best Hits

KEGG orthology group: None (inferred from 64% identity to dar:Daro_3027)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJA7 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Dsui_3244 GMP synthase family protein (Dechlorosoma suillum PS)
MRPVAIFRHTPTEGPGYFATFLEGHGIAWELIPVDAGAPVPASPEAYAGLCFMGGPMSVN
DPLPWIDHTCALIRSAVAAGIPVLGHCLGGQLMAKALGGRVTPNPIKEIGWGTARIEEGE
IPGHWFNGLGGEVTVFQWHGETFSLPPQAVRLLTNDFCANQMFALGPHLAMQCHVEMTPE
LIATWSSDWADEARAAARHPAGQTPEQMVAEIEWRLPAMRQLADRLYGAWIANLRR