Protein Info for Dsui_3243 in Dechlorosoma suillum PS

Annotation: clan AA aspartic protease, TIGR02281 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02281: clan AA aspartic protease, TIGR02281 family" amino acids 98 to 213 (116 residues), 110.9 bits, see alignment E=2.2e-36 PF13975: gag-asp_proteas" amino acids 111 to 200 (90 residues), 89.4 bits, see alignment E=1.9e-29 PF13650: Asp_protease_2" amino acids 111 to 197 (87 residues), 76.9 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K06985, aspartyl protease family protein (inferred from 60% identity to app:CAP2UW1_2140)

Predicted SEED Role

"FIG00575972: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJA6 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Dsui_3243 clan AA aspartic protease, TIGR02281 family (Dechlorosoma suillum PS)
MATGHSSLGWLSCLCLLLASPLQAVEVGIAGVFPNKALLVIDGAPPKGVAVGQKTEQGVK
LVAVEDGAAIIEVDGKRRTLRVGQSVVSQQSSDRTPTLTLSSDASGHFYATGNINGGTIR
FLVDTGATMVSIGASDARRLGLDLRNAQVGYTQTANGTARVYKVLLSTVRIGDVTLTDVD
GLVHESDMPIALLGMSFLNRMEMQRDGQRMILKKRY