Protein Info for Dsui_3238 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 156 to 176 (21 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF13426: PAS_9" amino acids 22 to 110 (89 residues), 41.2 bits, see alignment E=4.2e-14 PF00989: PAS" amino acids 24 to 112 (89 residues), 41.8 bits, see alignment E=2.4e-14 TIGR00229: PAS domain S-box protein" amino acids 24 to 114 (91 residues), 45.3 bits, see alignment E=4.5e-16 PF08448: PAS_4" amino acids 25 to 112 (88 residues), 24.4 bits, see alignment E=7.2e-09 PF08447: PAS_3" amino acids 31 to 112 (82 residues), 57.3 bits, see alignment E=3.9e-19 PF00015: MCPsignal" amino acids 349 to 504 (156 residues), 133.9 bits, see alignment E=1.3e-42

Best Hits

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJA1 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Dsui_3238 PAS domain S-box (Dechlorosoma suillum PS)
MKNNLPVTQVEVPFIKGKYIVSKTDLKGIITYANDTFVELSGFTRDELIGKNHNLVRHPD
MPPAAFADLWISVKEGRPWRGIVKNRCKNGDHYWVDALVVPVRQKGQTIGYMSVRTEPSR
AQVQSAEALYAKLGKGGGAIPRPGGWRKVSLRKKMAGLTLFVMAAQLLTGIGVWFGSGIG
FSADSIVALVQILSLTGLVAGAVQIGLQQGIFRAIDATNSSLDRVAQGDLSEDLWHDRLD
EVGKLQDSLLTTQAHLKVMLAEIAEAANRVSGNTTQLNLEMSSVSSQSESQSDSVSRIAA
SMEEMSATVEQVSADAQETASAVGTTRERIAGVEQRMIQGREASRAVVSAVDTASNTMAT
LFQSLNRIGVVTQGIQEIADQTNLIALNAAIEAARAGEAGRGFAVVADEVRKLAERTRLQ
TAEIAEMVTEIQKITESAVGSIESAGAQVGHNDEAMGETGVSLAEVVQDGQHIDEMARHI
AQATVQQSQASQDVAMSVSEIAALIEENAAAIGEAERNVQQLLATAGELRNLIAYFQFQP
GR