Protein Info for Dsui_3213 in Dechlorosoma suillum PS

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00571: CBS" amino acids 14 to 60 (47 residues), 30.2 bits, see alignment E=2.3e-11 amino acids 71 to 125 (55 residues), 31.2 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to azo:azo1032)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIT5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Dsui_3213 CBS domain-containing protein (Dechlorosoma suillum PS)
MHVRDILAIKGTVLFTAMPQQTLDNAVAAMAENDVGSLVVMGGGKMVGMLTFREVLKAVH
RHKGNLASVKVEDVMLSAPITASPDMETNELRHLLIENHQRYVPVMDGTTLMGVLSFLDV
AKSVLEEQNFENKMLKNYIKNWPDEEGSA