Protein Info for Dsui_3208 in Dechlorosoma suillum PS

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 7 to 292 (286 residues), 254.4 bits, E=7.8e-80
• TIGR01136: cysteine synthase
  • amino acids 8 to 305 (298 residues), 445.2 bits, E=1.2e-137
• TIGR01139: cysteine synthase A
  • amino acids 8 to 305 (298 residues), 461 bits, E=1.6e-142

Best Hits

Swiss-Prot: 70% identical to CYSK_MYCTU: O-acetylserine sulfhydrylase (cysK1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 84% identity to dar:Daro_4128)

MetaCyc: 56% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (8/9 steps found)
• L-cysteine biosynthesis I (2/2 steps found)
• seleno-amino acid biosynthesis (plants) (2/5 steps found)
• superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

See G8QIT0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Dsui_3208 cysteine synthase A (Dechlorosoma suillum PS)
MKIAKDVTQLVGKTPLVQLNRVAAGIEGTVALKLEYFNPAHSVKDRIAVAMIDAAQAAGK
IKPDTIVLEPTSGNTGIGLAMVCAARGIKAAFVMPETMSRERKLLLKAYGAELILTPGPE
GMGGAIKKAQELAESDSRYFIPQQFENPANPEVHRNTTAEEIWADTDGQVDIFVAGVGTG
GTVTGVGEVLKARKPGVQVFAVEPDASPVLSGGAKGPHPIQGIGAGFVPAVLNTQVYDGV
VRVKNDDAFATARRLATEEGLLVGISSGAAVWAALEIARKPENKGKLTVVVIPSFGERYL
STALYQHLEV