Protein Info for Dsui_3199 in Dechlorosoma suillum PS

Annotation: 3-isopropylmalate dehydratase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 1 to 196 (196 residues), 269.8 bits, see alignment E=6.2e-85 PF00694: Aconitase_C" amino acids 1 to 132 (132 residues), 132.9 bits, see alignment E=1.4e-42 PF27512: LeuD" amino acids 136 to 173 (38 residues), 47.8 bits, see alignment 1.5e-16 PF27434: LeuD_C" amino acids 185 to 211 (27 residues), 61 bits, see alignment (E = 8.2e-21)

Best Hits

Swiss-Prot: 81% identical to LEUD_DECAR: 3-isopropylmalate dehydratase small subunit (leuD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 81% identity to dar:Daro_0863)

MetaCyc: 61% identical to maleate hydratase small subunit (Pseudomonas alcaligenes NCIMB 9867)
Maleate hydratase. [EC: 4.2.1.31]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.31 or 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIS1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Dsui_3199 3-isopropylmalate dehydratase, small subunit (Dechlorosoma suillum PS)
MQAFTKLDGLVAPLDRNNVDTDAIIPKQFLKSIKRSGFGPNAFDEWRYMDHGEPGMDNSK
RPLNPNFVLNQQRYQGASVLLTRSNFGCGSSREHAPWALLDYGFRVVIAESFADIFFNNC
FKNGILPIVLPKTEIDALFGLTEYTPGFKLVVDLEQQKVVRPDGHAIPFEVDAFRRECLL
NGWDDIGLTLRHADKIKAFEERRRAEQPWLFS