Protein Info for Dsui_3188 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF05036: SPOR" amino acids 171 to 242 (72 residues), 46.7 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K03749, DedD protein (inferred from 37% identity to lch:Lcho_1686)

Predicted SEED Role

"DedD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIR0 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Dsui_3188 hypothetical protein (Dechlorosoma suillum PS)
MQVTDSDAQLQLKKRARRRLVGAVAFVTFAAIVLPMVMDQAPPPPTPDVQIRIPGQDQTA
FNPQALTTPAPAKPSAPARTELAPPPVVAVAPAAEAPAKPAEKPPVVTPAPVEKPAVKPV
DRTAEKQAAEKAAADKAAAAEKAKAEAEAKRAAALLGAGKPEAAKPAAAAGQHVILIGAF
ANPGNVKVLQTKLNEIGVKSYTENLDSPQGAKTRVRAGPFPSKEAAEKALDKMKKIGVNG
IVSAK