Protein Info for Dsui_3181 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 372 (336 residues), 259.8 bits, see alignment E=1.5e-81 PF16576: HlyD_D23" amino acids 61 to 290 (230 residues), 45.7 bits, see alignment E=1e-15 PF13437: HlyD_3" amino acids 172 to 287 (116 residues), 24.7 bits, see alignment E=6.6e-09 PF00529: CusB_dom_1" amino acids 182 to 358 (177 residues), 31.2 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 39% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to ddd:Dda3937_00786)

MetaCyc: 39% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIQ3 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Dsui_3181 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MKKSLPQLRPLLVSLFALTLAACGGGEPPQEMPPPIVSTIVVETRPVHLEDELPGRVSAL
RTAEIRPQVGGIVLRRLFEQGAEVQAGQPLFQINPAPFKAEVDSAASALKRAVAAMERAK
LQVDRLKPLVNADAVSQQLFDDALSQYNQSSADVAQAKAALARRQLDLDFATIRSPIAGR
IGEELVTEGALVGQSDANPMARVQQIDQVYVDVRQPASMLEAIRKSAGQSASSDGGKDGN
VKILDAQGNPYPVSGHILFSGINVDAGTGDVVIRIRVNNPERHLLPGMFVRARVPQGGDI
QGLLVPQQVVSRSSTGQARVWVVGQDGKAGVKNVELGKLVERQYLVRSGLAAGERVIVEG
QDRLQPGMPVSAQPWALAADGKTVAP