Protein Info for Dsui_3178 in Dechlorosoma suillum PS

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 325 to 357 (33 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 243 (224 residues), 188.6 bits, see alignment E=1.7e-59 PF02687: FtsX" amino acids 283 to 396 (114 residues), 60.2 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 76% identity to dar:Daro_3916)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIQ0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Dsui_3178 ABC-type antimicrobial peptide transport system, permease component (Dechlorosoma suillum PS)
MFLNAILLALREIRRNLMRSFLTVLGIVIGVAAVITMVTLGNGATRMVAEQISSLGSNLL
ILRPGQRLGPGRDSAGAPNFRAADVEALLTQVPSLKAVAPVVSSTVTLVAGAENWSSSVT
GSTNAYFVAGNWKLAAGRQFSDEEMRAGKAVCVIGNTVKQKLFAGQSPLGNAVRVKNFSC
EIVGILASKGQGAMGMDQDDVVLMPLVTAQRRLTGKTQDVSTLMLSLKDGASSPRVMEQI
RQLMRERRKLAENDDDNFNLMDTKQIAEALSGTIGTMTTLLGAVAAVSLLVGGIGIMNIM
LVSVTERTREIGIRLAIGALENEVLLQFLIEAVALSAFGGLVGIILALLACLGLSALMGM
PFLFNPGINLLAFGFSAAIGVIFGYVPARRAAGLDPIEALRHE