Protein Info for Dsui_3167 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 85 to 100 (16 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 167 to 328 (162 residues), 83.6 bits, see alignment E=6.3e-28 PF00990: GGDEF" amino acids 170 to 325 (156 residues), 119.7 bits, see alignment E=1.1e-38 PF00563: EAL" amino acids 348 to 582 (235 residues), 223.2 bits, see alignment E=3.3e-70

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIN9 at UniProt or InterPro

Protein Sequence (726 amino acids)

>Dsui_3167 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MVGAVNDEQALAILYDLALTIGGEVNVAPLMVRTLQRFMYHTGFPVGLWLVEEEGAADGR
CRLELAIGDYHLIRRQGESLALPAALVQGGPALFEAGALLAGLALRKPLGVVLRLPVPGQ
GVILLLGAARPATRLSLPELFSPILERLGRSITLCRSYELEVLHRVEQTAYYDPLTGLPN
AILFNNTLHQAVVRARATGRWLALVHLDVDDFRAFNEARGSDLGNRVLVALGQRFGASLQ
PGELLARIAGDEFMLLLPDLGGWDDVDERIVRTLQTNRTPLEIDGEAVEITFSAGIALLP
ADSEDGDTLVRHAQMALHQAKQEARGYFRLFDGEQDKRTHARREMLRRLDLAMENKELRL
YYQPKVDMPSGRVLGFEALLRWFHPERGMVPPGEFLPVVESSDFIIRLGEWAMREALAQA
VSWRRAGLETCISVNIAGRHLQLPDFPERVRHALADVPGARADSLEIEILESSILDDMAH
VREVMRACAGMGVRFALDDFGTGYSSLAYLHQLPAATIKIDQFFVRNLFEQREDPAIIQA
VVQIAQVFGRELVAEGVEDPEHGMLLVAMGCHIGQGFGIGRPMAAEAVLSWVAGYRARRE
WTALQGLAWHQGLYELFHLRHEHRQWRERVSARLAERAEAALPAFDACGLSQWLMIAAPG
GAPAQVRECFRLLGELAQQARGLEAARQNTAAPATMVLLGQMFASSDALLRLLDELGVRL
AARAAA