Protein Info for Dsui_3164 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 218 to 379 (162 residues), 166.8 bits, see alignment E=1.7e-53 PF00990: GGDEF" amino acids 223 to 375 (153 residues), 149 bits, see alignment E=5.2e-48

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIN6 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Dsui_3164 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPHIDLRTVILLAGFMTALMAVVLFFVTRSFPQRIRGIGHWAGGTLVGVFSGLLFGLRGL
IPDALSVLLANLLLYTALSLWLSGTELFYQRQPSWRFQALVSGVGLGLLTWFLLVQPDTN
ARLAVAGLSLPLFYGRQLLVVFRYGRPGFISRFFCLVLLAQIGVLLLRGSSALVPGLGSD
FLEQTPIQVVYLTAYPICTLMITVGYVLLATDRLRGELEYLSSHDSLTKILNRRAFVEVC
EWEMARARRHGRALCLLMLDLDFFKKINDTYGHQAGDLVLQGFVQRVGAVLRRGEHFGRY
GGEEFVVLLPDADLEQARQVAERIRLTTAEGPAQLPPVTVSIGVAALEAADTNLDCLLSQ
ADNAMYLAKANGRNRIEVAAAGTREEGAGVSPAAPAP