Protein Info for Dsui_3158 in Dechlorosoma suillum PS

Annotation: Na+/H+ dicarboxylate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 333 to 362 (30 residues), see Phobius details PF00375: SDF" amino acids 10 to 403 (394 residues), 393.4 bits, see alignment E=5.9e-122

Best Hits

Swiss-Prot: 79% identical to DCTA_CHRVO: C4-dicarboxylate transport protein (dctA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 79% identity to cvi:CV_3707)

MetaCyc: 67% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIN0 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Dsui_3158 Na+/H+ dicarboxylate symporter (Dechlorosoma suillum PS)
MSHKPFYKRLYVQVLFAIALGVALGAFFPETGATMKPLGDAFIKLIKMMIAPIIFATVVV
GIAKMGDMKEVGRVGLKALIYFEVVSTVALAIGLIVVNILQPGAGMNVDPSTLDTKAIAN
YAAAAHNQSTTDFLMNIIPNSVVDAFAKGEILQVLLFSVLFGLALSRLGDKAKPLVKILD
EFSHGLFGVIGMIMHFAPIGAFGAMAFTIGKYGIGSLKQLGFLMANVYITCALFVFVVLG
LIAKFTGFSLLKFLAYIKEELLIVLGTSSSESALPRMMTKLENLGCHKPVVGMVIPTGYS
FNLDGTSIYLTMAAIFIAQALNVPLTLTEQLTILGVLLLTSKGAAAVTGGGFITLAATLA
TLGGKLPVEGLALLLGVDRFMSEARAITNLIGNGVATIVVSKWENALNTDRMTRVLNGET
VEEADEPEAVSDAVLHPADLVRPVGKAA