Protein Info for Dsui_3153 in Dechlorosoma suillum PS

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 415 (409 residues), 449.6 bits, see alignment E=5e-139 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 528.8 bits, see alignment E=4e-163

Best Hits

Swiss-Prot: 55% identical to DCTM_PSEAE: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 88% identity to dar:Daro_2991)

MetaCyc: 34% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI82 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Dsui_3153 TRAP transporter, DctM subunit (Dechlorosoma suillum PS)
MNAAIIFGLLLALMLTGMPISISLGLTVLTFLFTMTQVPIESVALKLFTGIEKFEIMAIP
FFILAGNFLTHGGVARRMINFASAMVGHFYGGLGLAGVLACALFAAVSGSSPATVVAIGS
ILLPAMVRAGFPNRFGAGVITTSGALGILIPPSIVMVMYSVATNTSVGALFMAGVIPGLL
LAFTLGMVTWYRAKKFDYPRMPKASWGERWVAFRKSVWGLMLIVIVMGGIYTGMFTPTEA
AAMSAVYAFIVAVFVYKDMGLKQIPKVLLDSANMSAMLLYIITNAVLFSFLMTNENIPQL
LAEWLLDKGLGPIAFLLAVNVLLLVAGNFMEPSSIVLIMAPILFPVAVKLGIDPVHFGIL
IVVNMEVGMCHPPVGLNLYVASGITKMGITELTIAVWPWLLSMLCFLGLVTYWPTLSLWL
PRTLGML