Protein Info for Dsui_3152 in Dechlorosoma suillum PS

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details PF13493: DUF4118" amino acids 11 to 117 (107 residues), 85.1 bits, see alignment E=4.4e-28 PF00512: HisKA" amino acids 264 to 330 (67 residues), 47.2 bits, see alignment E=2.8e-16 PF02518: HATPase_c" amino acids 375 to 483 (109 residues), 87.4 bits, see alignment E=1.4e-28

Best Hits

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI81 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Dsui_3152 histidine kinase (Dechlorosoma suillum PS)
MGHLLQRFSGYLMGMLFVLLGTALAAPFRAEIDLSNLALLYVLAVVAVGGHFGRGPAVAC
ALAGSLAFAYVFVPPHFSLAITEIQYVMAAVIMVVVALVVGHLTAALRTQVELARDRARR
ARALYELAKHLAGSQTAEEVTQTCRRFLADALGARRIRLLEPATWDQPPPFITKALVRAC
LERRQLVAIPSPAPGISRALLPLAGTRDLQGLLGFEVDSGTLDDGEYREALDTMASVVAV
ALERTQYAAAVRESELRVAAETLRGTILASLSHDLRTPLTALVGMADGLALGKVVGAEKQ
KSMLLRLRDQALAINQLLGNLLEMARLRSGNVELQKEWQPIEEVIGATMGLMEPHAGGRE
IVINIAPELPPVHIDGVLIERVLWNLLENALKYSPAEQSIELRVAQSEGWLELSVCDRGE
GLAPGQEEDLFGLFRRGRSESNVPGAGLGLAIARTIAEAHGGSVSAANRSGGGACFCLRL
PLETPPDLADLADLESETP