Protein Info for Dsui_3145 in Dechlorosoma suillum PS

Annotation: 23S rRNA m2A2503 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF21016: RlmN_N" amino acids 3 to 61 (59 residues), 87.7 bits, see alignment E=3.5e-29 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 3 to 354 (352 residues), 452.5 bits, see alignment E=4.6e-140 PF04055: Radical_SAM" amino acids 104 to 278 (175 residues), 62.2 bits, see alignment E=6.9e-21

Best Hits

Swiss-Prot: 85% identical to RLMN_DECAR: Dual-specificity RNA methyltransferase RlmN (rlmN) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 85% identity to dar:Daro_2988)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI74 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Dsui_3145 23S rRNA m2A2503 methyltransferase (Dechlorosoma suillum PS)
MQNLLDFDAEGLTAWFAARGEKPFRARQVLRWMHHFGQADFDAMTDIAKSLREMLKANAV
VLPPAIVSDKLSDDGTRKFLFDVGNGNAVETVFIPEDDRGTLCISTQAGCALDCAFCSTG
KQGFNRNLAVSEIIGQLWQANRALGVDPRHPDKAERIISNVVLMGMGEPLANFEAAVAAL
KLMLDDNAYGLSRRRVTVSTSGLVPAMDRLRDECPVALAVSLHAPNDKLRDELVPINQKY
PIAELMAACQRYLEKAPRDFVTFEYVMLDGVNDSDAHARELLAITRDVPCKFNLIPFNPF
PGSPFRRSKAERIRRFADILIQAGVVTTTRKTRGDDIDAACGQLAGQVQDKTRRNERRTI
PIQEMRP