Protein Info for Dsui_3142 in Dechlorosoma suillum PS

Annotation: 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR00612: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase" amino acids 9 to 398 (390 residues), 389 bits, see alignment E=1.1e-120 PF04551: GcpE" amino acids 14 to 282 (269 residues), 271.5 bits, see alignment E=7e-85 PF26540: GcpE_C" amino acids 298 to 399 (102 residues), 75.4 bits, see alignment E=3e-25

Best Hits

Swiss-Prot: 81% identical to ISPG_DECAR: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 84% identity to app:CAP2UW1_2111)

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI71 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Dsui_3142 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (Dechlorosoma suillum PS)
MSDPYSIPRRPTLGVKVGGVTIGGDAPVVVQSMTNTDTEDYLATALQTAELARAGSELVR
ITVNTPEAAAAVPKIREHLDRLGLSVPLIGDFHYNGHRLLTDHPECAQALAKYRINPGNV
GHGKKRDEQFAQMIELACKYDKPVRIGVNWGSLDQDLLARIMDENAKRPEPKDAVQIMRE
AMVTSALESAEKAVEIGLPADHIVLSCKVSGVQDLIAIYRELSARSRFALHLGLTEAGMG
SKGIVASTAAMGVLLQEGIGDTIRVSLTPEPGGKRTGEVIVAQEMLQTMGLRAFTPMVAA
CPGCGRTTSTFFQELASTIQEYVRAQMPQWRTEYDGVENMTLAVMGCVVNGPGESKHANI
GISLPGTGEVPAAPVFEDGEKTVTLRGDNIAEEFKAIVDRYVARTYQRKLHP