Protein Info for Dsui_3135 in Dechlorosoma suillum PS

Annotation: HflK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 72 to 96 (25 residues), see Phobius details PF12221: HflK_N" amino acids 9 to 52 (44 residues), 40.9 bits, see alignment 1.5e-14 TIGR01933: HflK protein" amino acids 93 to 366 (274 residues), 320.2 bits, see alignment E=4.9e-100 PF01145: Band_7" amino acids 95 to 280 (186 residues), 85.2 bits, see alignment E=5.5e-28

Best Hits

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 76% identity to dar:Daro_2978)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI64 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Dsui_3135 HflK protein (Dechlorosoma suillum PS)
MISSIGLLMSLNDPQWGNRGNGDGRRPNQGPPDLEDLWRDFNRRLSGMFGKKGDGKFGGG
DSGGPSDFNPKLFGGGIGLLAALVAVVWLASGFYIVDASQRGVVLQFGKFKETTEPGLRW
RLPFPIESHELVNLTGVRTIEVGYRGSEKNKVLKEALMLTDDENIINIQFAVQYYLKDPV
EYLFNNRHADEAVMQASETAIREIVGKSKMDFVLYEGREQVAAQAAKLMQDILDRYNTGI
LISKVTMQNAQPPEQVQAAFDDAVKAGQDRERQKNEGQAYANDVIPRAKGTSARLLQEAD
GYKQRMIATAEGDASRFKQILVEYAKAPEVTRQRLYLETMQQIYANTSKIMVDAKGGNNL
LYLPLDKLMETVAAPGHAGVPAAQAVESTVNRGVSISNDVPPQLEKNDVRSRDASLRSRD
RDGR