Protein Info for Dsui_3125 in Dechlorosoma suillum PS

Annotation: cytochrome c, mono- and diheme variants family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 40 to 110 (71 residues), 53.6 bits, see alignment E=3.3e-18 PF00034: Cytochrom_C" amino acids 42 to 110 (69 residues), 26.8 bits, see alignment E=1.6e-09 PF02239: Cytochrom_D1" amino acids 148 to 523 (376 residues), 359.9 bits, see alignment E=1.7e-111

Best Hits

KEGG orthology group: None (inferred from 69% identity to dar:Daro_3260)

Predicted SEED Role

"Nitrite reductase associated c-type cytochorome NirN" in subsystem Dissimilatory nitrite reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI56 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Dsui_3125 cytochrome c, mono- and diheme variants family (Dechlorosoma suillum PS)
MKTRVQAARRPSSLAFWLLSVPLGLGALWLASRPAHAADANAPALFQQHCAACHGADRLG
GMGPALLPENLERLRKAEALKTIREGRAATQMPAFKDQLSEADIAALADYAYAPVNPKPT
WTEKDIRASRIQHVDEKTLSPRPVFKADPMNLFVVVEGGDHHVSILDGDKLEPIHRFQSR
YALHGGPKFSPDGRFVYFASRDGWLTKFDLWNLKVVAEVRAGINTRNAAVSGDGKYVMAA
NYLPQDLVLFDADLNLIKVMEAKSADGKESSRVSAVYDAAPRKSFVAAMKDMPEVWEISY
DPEAHPIYDGLVHDYQYKEGVSVPGFLNPRRTRLTDPLDDFFFDQSYSEVMGTSREGKGQ
VVNLDARRKVSELQLSGMPHLGSGITWNWQGRTVMASTNLKEGKVTVIDMKDWKPVKDIV
TRGAGFFLRSHENSRYAFVDSMMSPAKDTLQVIDKDKLEIVKELKPVPGKTLAHIEFTKD
GRYALASLWEMDGALIIYDARTLEEVKRLPMKKPVGKYNVWNKITRSEGTSH