Protein Info for Dsui_3119 in Dechlorosoma suillum PS

Annotation: nitric oxide reductase activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 455 to 477 (23 residues), see Phobius details PF00092: VWA" amino acids 451 to 578 (128 residues), 27.4 bits, see alignment E=1.9e-10

Best Hits

Predicted SEED Role

"Nitric oxide reductase activation protein NorD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI50 at UniProt or InterPro

Protein Sequence (615 amino acids)

>Dsui_3119 nitric oxide reductase activation protein (Dechlorosoma suillum PS)
MEEFVGKLWHRWITQAAGGHYPKAAVKLKEVERTAGILFRAFGGDPGLRVAAAVEVRHGA
RRRWLSRVAGSDEKATPATLDLATLRLPPEIAAFPDAALNRDLYLWLAALAAAGQQPGAA
AETDSCRRNQAATRRALACWPGLAPRYRRLVQAHLAQRLNPDSLPAAERPREEAIRRALL
EPGSVDALPRSPVPSRPVMLWLGDFGTEPHGATQPSREAPTEDQAGSQQLKEEEERRAHQ
TERVEMPTEKNGMLMMFRAESIFSWGEYVKVNRPTDDDPNEDAVAAANDLDQLALADDSE
KVASKVRFDLDLPSAAEDDVILGDGIPLPEWDYRKGQLLEEHVRLLEVTPQAASDSALPH
RLARTARRLHQQFAALLPARRWLKGQPDGQELDVDAAVRAHADRATGSHPTDNLYLSLEK
RERDLACLVLADLSLSTDTWVSDEARVIDVVKDALLLFGTAMGATGDAFALCGFSSLKRS
QVRFSRLKDFGQKFDAAARGRILALKPGYYTRLGAAIRHAASQLARQPASRRVLLILSDG
KPNDLDIYDGRYGIEDTRMAIIEARKLGLQPFCVTIDREGASYLPHLFGPAGYAVIRKPE
ELPRRLPLLYAQLTR