Protein Info for Dsui_3113 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 793 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 238 to 351 (114 residues), 35.6 bits, see alignment E=9.3e-13 PF00989: PAS" amino acids 240 to 340 (101 residues), 23.2 bits, see alignment E=1.4e-08 PF13188: PAS_8" amino acids 240 to 280 (41 residues), 24.1 bits, see alignment 6.3e-09 PF08448: PAS_4" amino acids 245 to 348 (104 residues), 33.3 bits, see alignment E=1.3e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 355 to 513 (159 residues), 87.4 bits, see alignment E=8.8e-29 PF00990: GGDEF" amino acids 359 to 511 (153 residues), 114.6 bits, see alignment E=9.8e-37 PF00563: EAL" amino acids 533 to 768 (236 residues), 275.1 bits, see alignment E=1.1e-85

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI44 at UniProt or InterPro

Protein Sequence (793 amino acids)

>Dsui_3113 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MRCPPKRNILSRAVWAMAGVTLLVGTLVIGITWVVTNHLAQQEANNRLGELLDTIEETVR
IACFIEDAQLATEVARGLIRNSEVAAVSIRSLNQELGREERSGQLSQNSAAALRRDIYSP
FDPTRRVGEIELQPNREALEQRTFRESLFVGLVLAAQLALLTLAVIFIVLRLIVAPIKAI
SDRLHLLKPTLGERLPAPPGHGGNEIGRLVDDINGLTEDLVAALEEEHSLRLRQAMDERK
YRHIFENAESGIFVADGQGTLLSHNRSLARLSGQEERPGGMPPNLLALPWGQPEQTAALL
RSCLESNSAQEDDLELALPDNPRWLHLSLTPIGDALVQGIASDITQRKLVETFAQRMTVT
DLLTSLGNRMGLEQQIREMIILHPEQPFALLLINLDGFKRINDGQGFDVGNELLLMAANR
LRNCIKGSDWLGRTSGDEFALLLPNVEGQEIPAKVAHRIVETLGLAYELGDTPAFVGSSV
GIALYPEDGRELLTLLRNAELALDRVKRSGGRDYQFFHPSMAAAAENRRRLENELRLAAE
RQELRLFYQPIVDIQQNRLAGAEALIRWVHPQQGMVPPDDFIPVAEETGLIQEIGLWVLE
TACDQLQQWRREGREDLYLSINVSGSQIPHGLPPSAVMEALSRRSLPPGALVLEITEGVL
MSDMKQALEWLQALRQVGIRIYLDDFGTGYSSLSYLKRFPVTTVKVDKSFVRDMGQDSSD
RALVEAIVAMTRSLGLEVVAEGVENEAQLALLRSMGTRYGQGYHFSRPVPASDFPAVAER
LETLLQAAPGTPG