Protein Info for Dsui_3097 in Dechlorosoma suillum PS

Annotation: O-6-methylguanine DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF02805: Ada_Zn_binding" amino acids 37 to 100 (64 residues), 105.4 bits, see alignment E=2.4e-34 PF00165: HTH_AraC" amino acids 127 to 157 (31 residues), 31.3 bits, see alignment (E = 3.4e-11) PF12833: HTH_18" amino acids 131 to 208 (78 residues), 69.4 bits, see alignment E=5.2e-23 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 308 to 387 (80 residues), 109.2 bits, see alignment E=3.9e-36 PF01035: DNA_binding_1" amino acids 309 to 388 (80 residues), 113.7 bits, see alignment E=5.8e-37

Best Hits

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI28 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Dsui_3097 O-6-methylguanine DNA methyltransferase (Dechlorosoma suillum PS)
MKNAAHAQSAPNLPAAKPGKTATGTAASAAAITADPRWAALCTRDPAAEGRFVYAVRSTG
IYCRPTCPSRRPKPENVQFFADGTAAAAAGFRPCRRCRPEEAPLAQRQAAVVADLCRFIE
AAETPPTLAQLAARAGLSPHHLHRLFQAHTGLTPGAYAKARRAERLRQNLAAGQGVTEAA
YGAGYNASSRLYSEAGRVLGMTPGRFRQGGAAEEIRFAVAQTSLGALLAARSARGLCAIL
LGDDPLALVADLQARFPKARLIGSGPEEEGQTAGAAGSADFAAWVAQVVGLVEAPRLGLA
LPLDLQGTAFQRRVWQALQAIPPGETRSYTEIARDLGLPKAVRAVAAACAANPLAVAVPC
HRVVRSDGNLAGYRWGLERKAALQQRERQQAENPAASTAPPHTKTVP