Protein Info for Dsui_3092 in Dechlorosoma suillum PS

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 11 to 462 (452 residues), 512.1 bits, see alignment E=1.5e-157 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 11 to 611 (601 residues), 813.7 bits, see alignment E=8.9e-249 PF00270: DEAD" amino acids 26 to 187 (162 residues), 80.8 bits, see alignment E=2.5e-26 PF00271: Helicase_C" amino acids 226 to 331 (106 residues), 64.1 bits, see alignment E=3.3e-21 PF16124: RecQ_Zn_bind" amino acids 343 to 404 (62 residues), 66.6 bits, see alignment E=6.8e-22 PF09382: RQC" amino acids 406 to 516 (111 residues), 132.2 bits, see alignment E=2e-42 PF00570: HRDC" amino acids 543 to 609 (67 residues), 87.2 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 71% identity to dar:Daro_0913)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI23 at UniProt or InterPro

Protein Sequence (612 amino acids)

>Dsui_3092 ATP-dependent DNA helicase RecQ (Dechlorosoma suillum PS)
METNTHTAALEILHRVFGYTAFRGSQGDIVGHVADGGDALVLMPTGGGKSLCYQIPALLR
HGCGVVISPLIALMQDQVDALTQLGVKAAYLNSTLDWQQVQEVERRVLCGDLDLLYVAPE
RLLTDRCLSLLDKLEEDKRLALFAIDEAHCVSQWGHDFRPEYLQLSALHNRYPDVPRIAL
TATADTATREEMRVRLGLTEARVFVASFDRPNIRYLIVEKDNPRKQLLAFLANHKGEAGI
VYCLSRKKVEETAAWLTSQGIPALPYHAGLPAEVRADNQRTFLREEGITMVATIAFGMGI
DKPDVRFVAHLDLPKSLEAYYQETGRAGRDGEPAEAWMAYGLQDVVLQRSRIEDSVAPEE
QKRLEAQKLNALLAYAESPRCRRVVLLDYFGEASEPCNNCDVCLTPPELWDGTVAAQKAL
SVVYRTGQRFGVVHLIDVLRGKVSDKVKQWGHDALPTFGVGADLDDGAWRAVFRQLVAGG
MLTADLAEHGAMKLTDAARPVLRGEQTLQMRRHVARKGGSGGGSKSRSERAPTKLDDMTL
EDQSLFEDLRQWRAATAKEQGVPAYVILHDKTLKELAEERPTTRDQLMNISGMGTAKLER
YGDDLLGIIRAA