Protein Info for Dsui_3091 in Dechlorosoma suillum PS

Annotation: integral membrane protein, TerC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 202 to 229 (28 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 7 to 314 (308 residues), 403 bits, see alignment E=4.6e-125 PF03741: TerC" amino acids 81 to 283 (203 residues), 187.5 bits, see alignment E=9.8e-60

Best Hits

Swiss-Prot: 56% identical to ALX_ECOL6: Putative membrane-bound redox modulator Alx (alx) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 63% identity to mmb:Mmol_0016)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI22 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Dsui_3091 integral membrane protein, TerC family (Dechlorosoma suillum PS)
MAESIGNLWWWVGFAVFVVVAIVVDLVALEKKGGRAVTARQALAWSALWVSLALIFCAIL
WGWLDHSVGREVANLKATEFLTGYLIEKSLSVDNIFVFLMIFTAFVVPAEQQKKALIVGV
ILAVVLRAVMILIGAWLISQFSWILYVFGAFLLVTGIKMALPGEHEPDIEQNPVLKWMRG
HLKILPQYDGDRLSVWKDGVRWFTPLFVVVVLIGVTDVIFAVDSIPAIFAVTTDPFIVMT
SNIFAILGLRALYFLLADMASRFHLLKYGLAAVLCFIGVKMLIVKWFHIPVFVSLGAVAG
ILAVSIVASLLRPEQATAGNR