Protein Info for Dsui_3089 in Dechlorosoma suillum PS

Annotation: UDP-2,3-diacylglucosamine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00149: Metallophos" amino acids 3 to 203 (201 residues), 37.2 bits, see alignment E=2.2e-13 TIGR01854: UDP-2,3-diacylglucosamine diphosphatase" amino acids 3 to 228 (226 residues), 247.2 bits, see alignment E=6.3e-78

Best Hits

Swiss-Prot: 52% identical to LPXH_AROAE: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 52% identity to eba:ebA4786)

MetaCyc: 44% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.1.54

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI20 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Dsui_3089 UDP-2,3-diacylglucosamine hydrolase (Dechlorosoma suillum PS)
MLYFISDLHLSPAVPGITALFLDFLASLPGRQASSLYILGDFFDHWVGDDDCTDPYNARI
IAALRQAADQGIELNLLHGNRDFLLGQDFATAAGLRLLPDPYVLSVVTWQFVLSHGDILC
TDDRDYQDFRAQVRGAAWQGEFLAKPLAERKAIAAALRQRSEAIKAEKRDGADYLMDVNA
ATVEDFLRDNGYATLIHGHTHRPDRHDHIVDGIHCERWVLADWRQDASRAWGDCLVWDGE
TLQRENLQRPLA